PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AS_1FB5A49D7.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 251aa    MW: 26952 Da    PI: 10.3697
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AS_1FB5A49D7.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.55.1e-071491912163
                            HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            RqRKk+++ e ++ v +L  eN++L +e+ el+  +++l +e+
  Traes_6AS_1FB5A49D7.1 149 RQRKKMRLPEVQQLVRSLAVENESLHEEMRELQRACSALSKEN 191
                            9*************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.0E-4149187No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MATADDAVAA DIICSLRGAD LAGWTPPWSK RGRPMEEARE LSWPAVARGK RSRRRSPASS  60
SATAAAGGKA ARCARSSPAS PLDYSAGSAS LRSGASTSGG EDGAFCSPWH RRAATAPATA  120
TTKTTTKVGS IRRPQLTFQA PPPRPAGQRQ RKKMRLPEVQ QLVRSLAVEN ESLHEEMREL  180
QRACSALSKE NDKLETRIEQ SNSRNEAALK EQKGKQQQQL DQQQQQSPHD SFALPDLNLP  240
AQDGADGSAP C
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148154RQRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3642101e-157AK364210.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2022L02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233917.11e-108PREDICTED: uncharacterized protein LOC100835852
TrEMBLW5GCB30.0W5GCB3_WHEAT; Uncharacterized protein
STRINGBRADI3G06160.11e-108(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]